Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AADACL3 Peptide - C-terminal region

AADACL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP11-474O21.3

UniProt

Q5VUY0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AADACL3 Rabbit Polyclonal Antibody (orb585540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001096640

Preservative

Lyophilized powder

AA Sequence

YRKWLGPENIPERFKERGYQLKPHEPMNEAAYLEVSVVLDVMCSPLIAED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDELR2 (C-term) Rabbit Polyclonal Antibody
AP52327PU-N 400 µL

KDELR2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Smco3 Mouse Gene Knockout Kit (CRISPR)
KN516304 1 Kit

Smco3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAAP24 Human qPCR Primer Pair (NM_152266)
HP217566 200 Reactions

FAAP24 Human qPCR Primer Pair (NM_152266)

Sign In for Pricing
View Details
Tipiracil Hydrochloride
TRC-T444890-50MG 50 mg

Tipiracil Hydrochloride

Sign In for Pricing
View Details
2-Hydroxy Oleic Acid
TRC-H948765-25MG 25 mg

2-Hydroxy Oleic Acid

Sign In for Pricing
View Details
Tpd52 (BC004068) Mouse Tagged ORF Clone
MG201718 10 µg

Tpd52 (BC004068) Mouse Tagged ORF Clone

Sign In for Pricing
View Details