Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AAK1 Peptide - C-terminal region

AAK1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686F03202, DKFZp686K16132, FLJ23712, FLJ25931, FLJ31060, FLJ42882, FLJ45252, KIAA1048, MGC138170, MGC164568, MGC164570

UniProt

Q2M2I8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055726

Preservative

Lyophilized powder

AA Sequence

SGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTSR2 Adenovirus (Human)
32258051 1.0 mL

NTSR2 Adenovirus (Human)

Sign In for Pricing
View Details
CAMK2B (NM_172084) Human Over-expression Lysate
LC406828 20 µg

CAMK2B (NM_172084) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PDE10A Pre-designed siRNA Set B
SI011873B 1 Each

Human PDE10A Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain SE11) EPMA Polyclonal Antibody
MBS7171453 Inquire

Rabbit anti-Escherichia coli (strain SE11) EPMA Polyclonal Antibody

Sign In for Pricing
View Details
TIGIT Protein, Mouse, Recombinant (His)
TMPY-02669-01 5 µg

TIGIT Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
TIGIT Protein, Mouse, Recombinant (His)
TMPY-02669-02 10 µg

TIGIT Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details