Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AAK1 Peptide - C-terminal region

AAK1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686F03202, DKFZp686K16132, FLJ23712, FLJ25931, FLJ31060, FLJ42882, FLJ45252, KIAA1048, MGC138170, MGC164568, MGC164570

UniProt

Q2M2I8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055726

Preservative

Lyophilized powder

AA Sequence

SGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cyclin A1/CCNA1 Antibody Picoband® Fluoro647 Conjugated
PB9485-Fluoro647 100 µg/Vial

Anti-Cyclin A1/CCNA1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
DNA Polymerase beta Rabbit Polyclonal Antibody (APC)
orb1009163 100 µL

DNA Polymerase beta Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
PHF8 Knockout Hela Polyclonal Cells
ARG7854 1 Million

PHF8 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Porcine Acidic leucine rich nuclear phosphoprotein 32 family member C (ANP32C) ELISA kit
GTR10449742 96 Well

Porcine Acidic leucine rich nuclear phosphoprotein 32 family member C (ANP32C) ELISA kit

Sign In for Pricing
View Details
Rabbit Polyclonal MVK Antibody
NBP1-82824 0.1 mL

Rabbit Polyclonal MVK Antibody

Sign In for Pricing
View Details
P2RY13 Polyclonal Antibody
A67166-100 100 µL

P2RY13 Polyclonal Antibody

Sign In for Pricing
View Details