Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abca7 Peptide - middle region

Abca7 Peptide - middle region

Product Specifications

Product Name Alternative

ABCX, Abc51

UniProt

Q91V24

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abca7 Rabbit Polyclonal Antibody (orb578907) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038878

Preservative

Lyophilized powder

AA Sequence

DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish Ush2c/adgrv1 C terminus Rabbit Polyclonal Antibody (Fluoro647)
orb3088446 200 µL

Zebrafish Ush2c/adgrv1 C terminus Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
TGM5 Rabbit Polyclonal Antibody (Fluoro594)
orb3098593 100 µg

TGM5 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
CD300 (CD300LF) Human Over-expression Lysate
orb1352764 100 µg

CD300 (CD300LF) Human Over-expression Lysate

Sign In for Pricing
View Details
CaMKP Inhibitor
M14870-01 1 g

CaMKP Inhibitor

Sign In for Pricing
View Details
CaMKP Inhibitor
M14870-02 200 mg

CaMKP Inhibitor

Sign In for Pricing
View Details
CaMKP Inhibitor
M14870-03 5 mg

CaMKP Inhibitor

Sign In for Pricing
View Details