Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abcc12 Peptide - middle region

Abcc12 Peptide - middle region

Product Specifications

Product Name Alternative

4930467B22Rik, MRP9

UniProt

Q80WJ6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abcc12 Rabbit Polyclonal Antibody (orb578911) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766500

Preservative

Lyophilized powder

AA Sequence

NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRSF5 Protein Vector (Human) (pPM-C-HA)
PV133540 500 ng

SRSF5 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
AADAT Antibody, FITC conjugated
A63917-50UG 50 µg

AADAT Antibody, FITC conjugated

Sign In for Pricing
View Details
Rab1A Recombinant Rabbit Monoclonal Antibody [PSH03-62]
HA722021 100 µL

Rab1A Recombinant Rabbit Monoclonal Antibody [PSH03-62]

Sign In for Pricing
View Details
TENM1 siRNA (Mouse)
MBS8204704-01 15 nmol

TENM1 siRNA (Mouse)

Sign In for Pricing
View Details
TENM1 siRNA (Mouse)
MBS8204704-02 30 nmol

TENM1 siRNA (Mouse)

Sign In for Pricing
View Details
TENM1 siRNA (Mouse)
MBS8204704-03 5x 30 nmol

TENM1 siRNA (Mouse)

Sign In for Pricing
View Details