Abcc12 Peptide - middle region
Abcc12 Peptide - middle region
Product Specifications
Product Name Alternative
4930467B22Rik, MRP9
UniProt
Q80WJ6
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Abcc12 Rabbit Polyclonal Antibody (orb578911) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_766500
Preservative
Lyophilized powder
AA Sequence
NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
23909141 1x 10^6 Cells / 1.0 mL
HS2ST1 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details 
orb2921086-01 20 µg
Recombinant Bacillus cereus Antiholin-like protein LrgA (lrgA)
Sign In for Pricing
View Details orb2921086-02 100 µg
Recombinant Bacillus cereus Antiholin-like protein LrgA (lrgA)
Sign In for Pricing
View Details