Abcc2 Peptide - middle region
Abcc2 Peptide - middle region
Product Specifications
Product Name Alternative
AI173996, Abc30, Cmoat, Mrp2, cMRP
UniProt
Q8VI47
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Abcc2 Rabbit Polyclonal Antibody (orb578892) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_038834
Preservative
Lyophilized powder
AA Sequence
TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
128388-ML750 100 µL
IL12RB2 (Interleukin-12 Receptor Subunit beta-2, IL-12 Receptor Subunit beta-2, IL-12R Subunit beta-2, IL-12R-beta-2, IL-12RB2) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
TRV-0045230-01 24 Tests
ELISA Kit for Wingless Type MMTV Integration Site Family, Member 3A (WNT3A)
Sign In for Pricing
View Details TRV-0045230-02 48 Tests
ELISA Kit for Wingless Type MMTV Integration Site Family, Member 3A (WNT3A)
Sign In for Pricing
View Details TRV-0045230-03 96 Tests
ELISA Kit for Wingless Type MMTV Integration Site Family, Member 3A (WNT3A)
Sign In for Pricing
View Details TRV-0045230-04 5x 96 Tests
ELISA Kit for Wingless Type MMTV Integration Site Family, Member 3A (WNT3A)
Sign In for Pricing
View Details