Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abcc2 Peptide - middle region

Abcc2 Peptide - middle region

Product Specifications

Product Name Alternative

AI173996, Abc30, Cmoat, Mrp2, cMRP

UniProt

Q8VI47

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abcc2 Rabbit Polyclonal Antibody (orb578892) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038834

Preservative

Lyophilized powder

AA Sequence

TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC15 rabbit pAb
ES18300-01 50 µL

APC15 rabbit pAb

Sign In for Pricing
View Details
APC15 rabbit pAb
ES18300-02 100 µL

APC15 rabbit pAb

Sign In for Pricing
View Details
Human TLR8 Reporter Cell Line-HEK293
ABC-RC0058 1 Vial

Human TLR8 Reporter Cell Line-HEK293

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae MutS2 protein (mutS2), partial
MBS1369892 Inquire

Recombinant Streptococcus pneumoniae MutS2 protein (mutS2), partial

Sign In for Pricing
View Details
ST7OT4 siRNA Oligos set (Human)
67800171 3x 5 nmol

ST7OT4 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Anti-LYPLA1 Antibody Picoband®, Cy3 Conjugate
A07249-2-Cy3 100 µg/Vial

Anti-LYPLA1 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details