Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCC4 Peptide - C-terminal region

ABCC4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP11-74A12.1, EST170205, MOAT-B, MOATB, MRP4

UniProt

O15439

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABCC4 Rabbit Polyclonal Antibody (orb329816) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAC27077

Preservative

Lyophilized powder

AA Sequence

IAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human hyperpolarization activated cyclic nucleotide-gated potassium channel 3 polyclonal Antibody
MBS713171-01 0.1 mL

Rabbit anti-human hyperpolarization activated cyclic nucleotide-gated potassium channel 3 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human hyperpolarization activated cyclic nucleotide-gated potassium channel 3 polyclonal Antibody
MBS713171-02 5x 0.1 mL

Rabbit anti-human hyperpolarization activated cyclic nucleotide-gated potassium channel 3 polyclonal Antibody

Sign In for Pricing
View Details
Human Pancreas Specific Transcription Factor 1a (PTF1a) ELISA Kit
MBS4502087-01 48 Tests

Human Pancreas Specific Transcription Factor 1a (PTF1a) ELISA Kit

Sign In for Pricing
View Details
Human Pancreas Specific Transcription Factor 1a (PTF1a) ELISA Kit
MBS4502087-02 96 Tests

Human Pancreas Specific Transcription Factor 1a (PTF1a) ELISA Kit

Sign In for Pricing
View Details
Human Pancreas Specific Transcription Factor 1a (PTF1a) ELISA Kit
MBS4502087-03 5x 96 Tests

Human Pancreas Specific Transcription Factor 1a (PTF1a) ELISA Kit

Sign In for Pricing
View Details
Human Pancreas Specific Transcription Factor 1a (PTF1a) ELISA Kit
MBS4502087-04 10x 96 Tests

Human Pancreas Specific Transcription Factor 1a (PTF1a) ELISA Kit

Sign In for Pricing
View Details