Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abcf1 Peptide - C-terminal region

Abcf1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Abc50, Abcf1

UniProt

Q6MG08

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abcf1 Rabbit Polyclonal Antibody (orb578894) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IP, WB

NCBI Accession Number

NP_001103353

Preservative

Lyophilized powder

AA Sequence

GGKSTKQAEKQTKEVLTRKQQKCRRKNQDEESQDPPELLKRPREYTVRFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lig1 Rat siRNA Oligo Duplex (Locus ID 81513)
SR500138 1 Kit

Lig1 Rat siRNA Oligo Duplex (Locus ID 81513)

Sign In for Pricing
View Details
DEDAF (Death Effector Domain Associated Factor, APAP1) (PE)
MBS6472184-01 0.1 mL

DEDAF (Death Effector Domain Associated Factor, APAP1) (PE)

Sign In for Pricing
View Details
DEDAF (Death Effector Domain Associated Factor, APAP1) (PE)
MBS6472184-02 5x 0.1 mL

DEDAF (Death Effector Domain Associated Factor, APAP1) (PE)

Sign In for Pricing
View Details
Recombinant Canine Gap Junction Alpha-1 Protein (GJA1), N-His
AP1C71-01 1 mg

Recombinant Canine Gap Junction Alpha-1 Protein (GJA1), N-His

Sign In for Pricing
View Details
Recombinant Canine Gap Junction Alpha-1 Protein (GJA1), N-His
AP1C71-02 10 µg

Recombinant Canine Gap Junction Alpha-1 Protein (GJA1), N-His

Sign In for Pricing
View Details
Recombinant Canine Gap Junction Alpha-1 Protein (GJA1), N-His
AP1C71-03 200 µg

Recombinant Canine Gap Junction Alpha-1 Protein (GJA1), N-His

Sign In for Pricing
View Details