Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abcf1 Peptide - C-terminal region

Abcf1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Abc50, Abcf1

UniProt

Q6MG08

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abcf1 Rabbit Polyclonal Antibody (orb578894) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IP, WB

NCBI Accession Number

NP_001103353

Preservative

Lyophilized powder

AA Sequence

GGKSTKQAEKQTKEVLTRKQQKCRRKNQDEESQDPPELLKRPREYTVRFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse RNA-binding protein 12, RBM12 ELISA Kit
MBS9337617-01 48 Well

Mouse RNA-binding protein 12, RBM12 ELISA Kit

Sign In for Pricing
View Details
Mouse RNA-binding protein 12, RBM12 ELISA Kit
MBS9337617-02 96 Well

Mouse RNA-binding protein 12, RBM12 ELISA Kit

Sign In for Pricing
View Details
Mouse RNA-binding protein 12, RBM12 ELISA Kit
MBS9337617-03 5x 96 Well

Mouse RNA-binding protein 12, RBM12 ELISA Kit

Sign In for Pricing
View Details
Mouse RNA-binding protein 12, RBM12 ELISA Kit
MBS9337617-04 10x 96 Well

Mouse RNA-binding protein 12, RBM12 ELISA Kit

Sign In for Pricing
View Details
NOXIN Blocking Peptide
abx061904-01 1 mg

NOXIN Blocking Peptide

Sign In for Pricing
View Details
NOXIN Blocking Peptide
abx061904-02 5 mg

NOXIN Blocking Peptide

Sign In for Pricing
View Details