ABCF2 Peptide - middle region
ABCF2 Peptide - middle region
Product Specifications
Product Name Alternative
ABC28, DKFZp586K1823, EST133090, HUSSY-18, M-ABC1, HUSSY18
UniProt
Q75MJ1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ABCF2 Rabbit Polyclonal Antibody (orb578903) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005683
Preservative
Lyophilized powder
AA Sequence
YGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETI
More Discoveries
Explore Other Products
Browse additional items from our catalog
10622010-AAT 100 Tests
IFluor® 350 Anti-human CD62p Antibody *HI62P*
Sign In for Pricing
View Details TA800718S 30 µL
E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: OTI1B11]
Sign In for Pricing
View Details 
NBL1-14823 0.1 mg
PRPF4B Overexpression Lysate (Native) - (Dry Ice)
Sign In for Pricing
View Details