Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCG5 Peptide - middle region

ABCG5 Peptide - middle region

Product Specifications

Product Name Alternative

STSL

UniProt

Q9H222

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABCG5 Rabbit Polyclonal Antibody (orb578910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071881

Preservative

Lyophilized powder

AA Sequence

CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYBPC1 Antibody
6679-01mg 0.1 mg

MYBPC1 Antibody

Sign In for Pricing
View Details
TRIM24 Rabbit Polyclonal Antibody (RBITC)
orb1047549 100 µL

TRIM24 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
(-)-Altizide
MBS5778896-01 5 mg

(-)-Altizide

Sign In for Pricing
View Details
(-)-Altizide
MBS5778896-02 5x 5 mg

(-)-Altizide

Sign In for Pricing
View Details
MIP-1b (Macrophage Inflammatory Protein-1 b)
MBS615099-01 0.5 mg

MIP-1b (Macrophage Inflammatory Protein-1 b)

Sign In for Pricing
View Details
MIP-1b (Macrophage Inflammatory Protein-1 b)
MBS615099-02 5x 0.5 mg

MIP-1b (Macrophage Inflammatory Protein-1 b)

Sign In for Pricing
View Details