Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD1 Peptide - middle region

ABHD1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ36128, LABH1

UniProt

Q96SE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABHD1 Rabbit Polyclonal Antibody (orb580973) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115993

Preservative

Lyophilized powder

AA Sequence

GLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chemokine C-C-Motif Ligand 1 (CCL1)
TRV-0037170-01 10 µg

Recombinant Chemokine C-C-Motif Ligand 1 (CCL1)

Sign In for Pricing
View Details
Recombinant Chemokine C-C-Motif Ligand 1 (CCL1)
TRV-0037170-02 50 µg

Recombinant Chemokine C-C-Motif Ligand 1 (CCL1)

Sign In for Pricing
View Details
Recombinant Chemokine C-C-Motif Ligand 1 (CCL1)
TRV-0037170-03 100 µg

Recombinant Chemokine C-C-Motif Ligand 1 (CCL1)

Sign In for Pricing
View Details
Recombinant Chemokine C-C-Motif Ligand 1 (CCL1)
TRV-0037170-04 200 µg

Recombinant Chemokine C-C-Motif Ligand 1 (CCL1)

Sign In for Pricing
View Details
Recombinant Chemokine C-C-Motif Ligand 1 (CCL1)
TRV-0037170-05 500 µg

Recombinant Chemokine C-C-Motif Ligand 1 (CCL1)

Sign In for Pricing
View Details
Recombinant Chemokine C-C-Motif Ligand 1 (CCL1)
TRV-0037170-06 1 mg

Recombinant Chemokine C-C-Motif Ligand 1 (CCL1)

Sign In for Pricing
View Details