ABHD1 Peptide - middle region
ABHD1 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ36128, LABH1
UniProt
Q96SE0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ABHD1 Rabbit Polyclonal Antibody (orb580973) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_115993
Preservative
Lyophilized powder
AA Sequence
GLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0868005 3x 1.0 µg
GLRX3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
GTR15254762 1 Vial
Lentiviral mouse Fbxo34 shRNA (UAS) - Lentiviral mouse Fbxo34 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details 
MBS7170367 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) DMP9 Polyclonal Antibody
Sign In for Pricing
View Details