Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD12 Peptide - middle region

ABHD12 Peptide - middle region

Product Specifications

Product Name Alternative

ABHD12A, BEM46L2, C20orf22, DKFZP434P106, dJ965G21.2, PHARC

UniProt

Q8N2K0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABHD12 Rabbit Polyclonal Antibody (orb330394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035937

Preservative

Lyophilized powder

AA Sequence

CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC643355 (NM_001270945) Human Tagged ORF Clone
RG235829 10 µg

LOC643355 (NM_001270945) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ferritin, Light Chain (Node-Negative Breast Tumor Prognostic Marker) (rFTL/1388), CF405S conjugate, 0.1mg/mL
BNC043771-500 1x 500 µL

Ferritin, Light Chain (Node-Negative Breast Tumor Prognostic Marker) (rFTL/1388), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human MINA53 (MINA) activation kit by CRISPRa
GA113721 1 Kit

Human MINA53 (MINA) activation kit by CRISPRa

Sign In for Pricing
View Details
TIMP2 (NM_003255) Human Recombinant Protein
TP309796M 100 µg

TIMP2 (NM_003255) Human Recombinant Protein

Sign In for Pricing
View Details
4-(2-Hydroxyethyl)-1H-pyrrole-3-carboxylic Acid
TRC-H825350-25MG 25 mg

4-(2-Hydroxyethyl)-1H-pyrrole-3-carboxylic Acid

Sign In for Pricing
View Details
GBP2 (NM_004120) Human Over-expression Lysate
LC401329 20 µg

GBP2 (NM_004120) Human Over-expression Lysate

Sign In for Pricing
View Details