Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD12 Peptide - middle region

ABHD12 Peptide - middle region

Product Specifications

Product Name Alternative

ABHD12A, BEM46L2, C20orf22, DKFZP434P106, dJ965G21.2, PHARC

UniProt

Q8N2K0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABHD12 Rabbit Polyclonal Antibody (orb330394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035937

Preservative

Lyophilized powder

AA Sequence

CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MycoLight™ Ratiometric Bacterial Membrane Potential Kit *Red/Green Fluorescence*
22401-AAT 200 Tests

MycoLight™ Ratiometric Bacterial Membrane Potential Kit *Red/Green Fluorescence*

Sign In for Pricing
View Details
Human CNPY4 activation kit by CRISPRa
GA116697 1 Kit

Human CNPY4 activation kit by CRISPRa

Sign In for Pricing
View Details
2,4,5-Trichloroaniline-13C6
TRC-T774093-1MG 1 mg

2,4,5-Trichloroaniline-13C6

Sign In for Pricing
View Details
Ceftolozane Sulfate
TRC-C249100-1MG 1 mg

Ceftolozane Sulfate

Sign In for Pricing
View Details
Human CATSPER3 activation kit by CRISPRa
GA117660 1 Kit

Human CATSPER3 activation kit by CRISPRa

Sign In for Pricing
View Details
Patchouli Alcohol
TRC-P206200-25MG 25 mg

Patchouli Alcohol

Sign In for Pricing
View Details