Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABRA Peptide - middle region

ABRA Peptide - middle region

Product Specifications

Product Name Alternative

STARS

UniProt

Q8N0Z2

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABRA Rabbit Polyclonal Antibody (orb581794) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631905

Preservative

Lyophilized powder

AA Sequence

QWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OXR1, ID (OXR1, Oxidation resistance protein 1) (MaxLight 650) discontinued
039553-ML650 100 µL

OXR1, ID (OXR1, Oxidation resistance protein 1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
URM1 Protein Vector (Rat) (pPB-C-His)
PV314654 500 ng

URM1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Macrophage (AP)
MBS6401065-01 0.1 mL

Macrophage (AP)

Sign In for Pricing
View Details
Macrophage (AP)
MBS6401065-02 5x 0.1 mL

Macrophage (AP)

Sign In for Pricing
View Details
TAGL2 Rabbit Polyclonal Antibody (Cy7)
orb1040836 100 µL

TAGL2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
HSD11B1 Peptide
DF3972-BP 1 mg

HSD11B1 Peptide

Sign In for Pricing
View Details