Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABRA Peptide - middle region

ABRA Peptide - middle region

Product Specifications

Product Name Alternative

STARS

UniProt

Q8N0Z2

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABRA Rabbit Polyclonal Antibody (orb581794) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631905

Preservative

Lyophilized powder

AA Sequence

QWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFAF5 Polyclonal Conjugated Antibody
orb1626289 100 µL

NDUFAF5 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
NHE3 (Na, H Exchanger Isoform) discontinued
N2017-22 100 µg

NHE3 (Na, H Exchanger Isoform) discontinued

Sign In for Pricing
View Details
CDX4 3'UTR GFP Stable Cell Line
TU054126 1.0 mL

CDX4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
NALP4 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb886864 100 µL

NALP4 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
CACNA2D2 (Center) Rabbit pAb
MBS8556775-01 0.1 mL

CACNA2D2 (Center) Rabbit pAb

Sign In for Pricing
View Details
CACNA2D2 (Center) Rabbit pAb
MBS8556775-02 0.1 mL (AF405L)

CACNA2D2 (Center) Rabbit pAb

Sign In for Pricing
View Details