Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abt1 Peptide - middle region

Abt1 Peptide - middle region

Product Specifications

UniProt

Q9QYL7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abt1 Rabbit Polyclonal Antibody (orb576240) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038952

Preservative

Lyophilized powder

AA Sequence

RQRLRAEVAQAKRETDFYLRNVEQGQHFLAADGDATRPNSSWTFTQRPTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

∆2-Cefteram Pivoxil, 1:1 mixture with Cefteram Pivoxil (C244300)
TRC-C244310-5MG 5 mg

∆2-Cefteram Pivoxil, 1:1 mixture with Cefteram Pivoxil (C244300)

Sign In for Pricing
View Details
Manganese(II) Chloride Monohydrate
TRC-M164318-50G 50 g

Manganese(II) Chloride Monohydrate

Sign In for Pricing
View Details
ATP5F1B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E5]
TA500833BM 100 µL

ATP5F1B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E5]

Sign In for Pricing
View Details
Fmoc-D-Ile TentaGel® S TRT Resin
SAD1215.25G 25 g

Fmoc-D-Ile TentaGel® S TRT Resin

Sign In for Pricing
View Details
Human MAGEA2 (MAGEA2B) activation kit by CRISPRa
GA116948 1 Kit

Human MAGEA2 (MAGEA2B) activation kit by CRISPRa

Sign In for Pricing
View Details
SV2A Recombinant Rabbit monoclonal Antibody
HA751371 100 µL

SV2A Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details