Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abt1 Peptide - middle region

Abt1 Peptide - middle region

Product Specifications

UniProt

Q9QYL7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abt1 Rabbit Polyclonal Antibody (orb576240) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038952

Preservative

Lyophilized powder

AA Sequence

RQRLRAEVAQAKRETDFYLRNVEQGQHFLAADGDATRPNSSWTFTQRPTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXA1 Antibody
8C10645-AAT 50 µg

HOXA1 Antibody

Sign In for Pricing
View Details
ISG15 Rabbit Monoclonal Antibody [Clone ID: R08-1H5]
TA384548 100 µL

ISG15 Rabbit Monoclonal Antibody [Clone ID: R08-1H5]

Sign In for Pricing
View Details
4-Chlorobenzyl Bromide
TRC-C427623-500MG 500 mg

4-Chlorobenzyl Bromide

Sign In for Pricing
View Details
SLFN12L (NM_001195790) Human Over-expression Lysate
LC434325 20 µg

SLFN12L (NM_001195790) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS629709 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details
GCLC Polyclonal Antibody
E-AB-52359-01 20 µL

GCLC Polyclonal Antibody

Sign In for Pricing
View Details