Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abt1 Peptide - C-terminal region

Abt1 Peptide - C-terminal region

Product Specifications

UniProt

Q9QYL7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abt1 Rabbit Polyclonal Antibody (orb576241) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038952

Preservative

Lyophilized powder

AA Sequence

QEFRARKAARPGGRERARLANVEDQARSNRGLLAKIFGAPLPAESKEKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GMEB1 Antibody
NBP2-97215-50ul 50 µL

Rabbit Polyclonal GMEB1 Antibody

Sign In for Pricing
View Details
PKIb (Protein Kinase Inhibitor β) Rabbit ELISA Kit
F9135 96 Tests

PKIb (Protein Kinase Inhibitor β) Rabbit ELISA Kit

Sign In for Pricing
View Details
Boc-Leu-Arg-Arg-AMC
GL3169-1mg 1 mg

Boc-Leu-Arg-Arg-AMC

Sign In for Pricing
View Details
KIF3C (NM_002254) Human Mass Spec Standard
PH316137 10 µg

KIF3C (NM_002254) Human Mass Spec Standard

Sign In for Pricing
View Details
Anti-RPAIN Antibody Picoband®, Carrier-free
A11439-1-carrier-free 100 µg/Vial

Anti-RPAIN Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
4930519F16Rik Mouse qPCR Primer Pair (NM_029170)
MP213874 200 Reactions

4930519F16Rik Mouse qPCR Primer Pair (NM_029170)

Sign In for Pricing
View Details