Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abt1 Peptide - C-terminal region

Abt1 Peptide - C-terminal region

Product Specifications

UniProt

Q9QYL7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Abt1 Rabbit Polyclonal Antibody (orb576241) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038952

Preservative

Lyophilized powder

AA Sequence

QEFRARKAARPGGRERARLANVEDQARSNRGLLAKIFGAPLPAESKEKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cell division cycle protein 16 homolog (CDC16) ELISA kit
GTR10399071 96 Well

Mouse Cell division cycle protein 16 homolog (CDC16) ELISA kit

Sign In for Pricing
View Details
Anti-Phosphothreonine Ascites Antibody
MBS4157023-01 0.1 mL

Anti-Phosphothreonine Ascites Antibody

Sign In for Pricing
View Details
Anti-Phosphothreonine Ascites Antibody
MBS4157023-02 5x 0.1 mL

Anti-Phosphothreonine Ascites Antibody

Sign In for Pricing
View Details
ACIN1 Protein Vector (Mouse) (pPM-C-His)
PV151737 500 ng

ACIN1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
PAI 1 Blocking Peptide
MBS9616881-01 1 mg

PAI 1 Blocking Peptide

Sign In for Pricing
View Details
PAI 1 Blocking Peptide
MBS9616881-02 5x 1 mg

PAI 1 Blocking Peptide

Sign In for Pricing
View Details