Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAD9 Peptide - C-terminal region

ACAD9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACAD-9, FLJ23533, MGC14452, NPD002

UniProt

Q9H845

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACAD9 Rabbit Polyclonal Antibody (orb584802) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054768

Preservative

Lyophilized powder

AA Sequence

RSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxidase, Horseradish (HRP) (Not for Export EU)
P3350-27 2 mL

Peroxidase, Horseradish (HRP) (Not for Export EU)

Sign In for Pricing
View Details
Human ASB10 activation kit by CRISPRa
GA115272 1 Kit

Human ASB10 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Debaryomyces hansenii Inosine triphosphate pyrophosphatase (HAM1)
MBS1482798-01 0.05 mg (E-Coli)

Recombinant Debaryomyces hansenii Inosine triphosphate pyrophosphatase (HAM1)

Sign In for Pricing
View Details
Recombinant Debaryomyces hansenii Inosine triphosphate pyrophosphatase (HAM1)
MBS1482798-02 0.05 mg (Yeast)

Recombinant Debaryomyces hansenii Inosine triphosphate pyrophosphatase (HAM1)

Sign In for Pricing
View Details
Recombinant Debaryomyces hansenii Inosine triphosphate pyrophosphatase (HAM1)
MBS1482798-03 0.2 mg (E-Coli)

Recombinant Debaryomyces hansenii Inosine triphosphate pyrophosphatase (HAM1)

Sign In for Pricing
View Details
Recombinant Debaryomyces hansenii Inosine triphosphate pyrophosphatase (HAM1)
MBS1482798-04 0.5 mg (E-Coli)

Recombinant Debaryomyces hansenii Inosine triphosphate pyrophosphatase (HAM1)

Sign In for Pricing
View Details