Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAD9 Peptide - C-terminal region

ACAD9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACAD-9, FLJ23533, MGC14452, NPD002

UniProt

Q9H845

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACAD9 Rabbit Polyclonal Antibody (orb584802) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054768

Preservative

Lyophilized powder

AA Sequence

RSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd24a siRNA Oligos set (Mouse)
15510174 3x 5 nmol

Cd24a siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09752T3-01 20 Tests

Elab Fluor® Violet 540 Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09752T3-02 100 Tests

Elab Fluor® Violet 540 Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09752T3-03 2x 100 Tests

Elab Fluor® Violet 540 Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details
SDK2 CRISPR Knock Out 293T Cell Line (Human)
43267141 1x 10^6 Cells / 1.0 mL

SDK2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Mms2 (h) -PR
sc-72124-PR 10 µM - 20 µL

Mms2 (h) -PR

Sign In for Pricing
View Details