Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAD9 Peptide - C-terminal region

ACAD9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACAD-9, FLJ23533, MGC14452, NPD002

UniProt

Q9H845

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACAD9 Rabbit Polyclonal Antibody (orb584802) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054768

Preservative

Lyophilized powder

AA Sequence

RSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SAP97 Antibody (K64/29)
MBS1571502-01 0.1 mg

Anti-SAP97 Antibody (K64/29)

Sign In for Pricing
View Details
Anti-SAP97 Antibody (K64/29)
MBS1571502-02 1 mg

Anti-SAP97 Antibody (K64/29)

Sign In for Pricing
View Details
Anti-SAP97 Antibody (K64/29)
MBS1571502-03 5x 1 mg

Anti-SAP97 Antibody (K64/29)

Sign In for Pricing
View Details
Ataxin3 (MJD) Antibody (N-term) Blocking Peptide
MBS9231506-01 0.5 mg

Ataxin3 (MJD) Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Ataxin3 (MJD) Antibody (N-term) Blocking Peptide
MBS9231506-02 5x 0.5 mg

Ataxin3 (MJD) Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Nicastrin monoclonal antibody
orb1723802-01 50 µL

Nicastrin monoclonal antibody

Sign In for Pricing
View Details