ACAD9 Peptide - C-terminal region
ACAD9 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ACAD-9, FLJ23533, MGC14452, NPD002
UniProt
Q9H845
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACAD9 Rabbit Polyclonal Antibody (orb584802) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_054768
Preservative
Lyophilized powder
AA Sequence
RSIRIGLRNHDHEVLLANTFCVEAYLQNLFSLSQLDKYAPENLDEQIKKV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MR213528L3V 200 µL
Olfr951 (NM_001011812) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
GTR15390962 1 Vial
Lentiviral human TNIK sgRNA gene knockout kit - Lentiviral human TNIK sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 
orb2437556 100 µL
CHRNA2 (neuronal) Rabbit Polyclonal Antibody (BF555)
Sign In for Pricing
View Details MBS2905788-01 48 Well
Mouse Eif4e / Eukaryotic translation initiation factor 4E ELISA Kit
Sign In for Pricing
View Details