Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACADVL Peptide - C-terminal region

ACADVL Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACAD6, LCACD, VLCAD

UniProt

P49748

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACADVL Rabbit Polyclonal Antibody (orb330757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001029031

Preservative

Lyophilized powder

AA Sequence

IDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRT4 Recombinant Rabbit monoclonal Antibody
HA723752 100 µL

SIRT4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
RO60 Human Gene Knockout Kit (CRISPR)
KN206071 1 Kit

RO60 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse CD16/FCGR3 Protein (His Tag)
PKSM041338-01 10 µg

Recombinant Mouse CD16/FCGR3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD16/FCGR3 Protein (His Tag)
PKSM041338-02 50 µg

Recombinant Mouse CD16/FCGR3 Protein (His Tag)

Sign In for Pricing
View Details
PGCP (CPQ) (NM_016134) Human Recombinant Protein
TP304684L 1 mg

PGCP (CPQ) (NM_016134) Human Recombinant Protein

Sign In for Pricing
View Details
CXorf49B (NM_001145139) Human Over-expression Lysate
LY428718 100 µg

CXorf49B (NM_001145139) Human Over-expression Lysate

Sign In for Pricing
View Details