Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAT1 Peptide - middle region

ACAT1 Peptide - middle region

Product Specifications

Product Name Alternative

ACAT, MAT, T2, THIL

UniProt

P24752

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACAT1 Rabbit Polyclonal Antibody (orb330738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_000010

Preservative

Lyophilized powder

AA Sequence

GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3493), CF740 conjugate, 0.1mg/mL
BNC743493-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3493), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS631737 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Recombinant Mouse CD30 Ligand/TNFSF8 Protein (Fc Tag)
PDMM100135-01 20 µg

Recombinant Mouse CD30 Ligand/TNFSF8 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD30 Ligand/TNFSF8 Protein (Fc Tag)
PDMM100135-02 100 µg

Recombinant Mouse CD30 Ligand/TNFSF8 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD30 Ligand/TNFSF8 Protein (Fc Tag)
PDMM100135-03 500 µg

Recombinant Mouse CD30 Ligand/TNFSF8 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD30 Ligand/TNFSF8 Protein (Fc Tag)
PDMM100135-04 1 mg

Recombinant Mouse CD30 Ligand/TNFSF8 Protein (Fc Tag)

Sign In for Pricing
View Details