Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACBD3 Peptide - N-terminal region

ACBD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GCP60, GOCAP1, GOLPH1, PAP7

UniProt

Q9H3P7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACBD3 Rabbit Polyclonal Antibody (orb326224) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073572

Preservative

Lyophilized powder

AA Sequence

EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VP40 Mouse Monoclonal Antibody [B6-A8]
HA601066 100 µL

VP40 Mouse Monoclonal Antibody [B6-A8]

Sign In for Pricing
View Details
NAK / TBK1 Recombinant Rabbit monoclonal Antibody
HA723365 100 µL

NAK / TBK1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SPART (NM_001142294) Human Over-expression Lysate
LC428017 20 µg

SPART (NM_001142294) Human Over-expression Lysate

Sign In for Pricing
View Details
BCMO1 (BCO1) Human Gene Knockout Kit (CRISPR)
KN423790 1 Kit

BCMO1 (BCO1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CTNND1 Antibody
KC-385-01 50 μL

CTNND1 Antibody

Sign In for Pricing
View Details
CTNND1 Antibody
KC-385-02 100 µL

CTNND1 Antibody

Sign In for Pricing
View Details