Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Accn2 Peptide - N-terminal region

Accn2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI843610, ASIC, ASIC1, ASIC1a, B530003N02Rik, BNaC2, Accn2

UniProt

Q6NXK8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Accn2 Rabbit Polyclonal Antibody (orb575355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033727

Preservative

Lyophilized powder

AA Sequence

MELKTEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFTAP (NM_138787) Human Recombinant Protein
TP308417 20 µg

IFTAP (NM_138787) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human C-X-C Motif Chemokine 6/CXCL6 (C-6His)
PKSH033901-01 10 µg

Recombinant Human C-X-C Motif Chemokine 6/CXCL6 (C-6His)

Sign In for Pricing
View Details
Recombinant Human C-X-C Motif Chemokine 6/CXCL6 (C-6His)
PKSH033901-02 50 µg

Recombinant Human C-X-C Motif Chemokine 6/CXCL6 (C-6His)

Sign In for Pricing
View Details
LIMK2 Recombinant Rabbit Monoclonal Antibody [PSH08-82]
HA723034 100 µL

LIMK2 Recombinant Rabbit Monoclonal Antibody [PSH08-82]

Sign In for Pricing
View Details
Human SLC6A7 activation kit by CRISPRa
GA104458 1 Kit

Human SLC6A7 activation kit by CRISPRa

Sign In for Pricing
View Details
CellBrite® NIR770 Cytoplasmic Membrane Dye, 2 mM in DMSO
#30078 1x 100 µL

CellBrite® NIR770 Cytoplasmic Membrane Dye, 2 mM in DMSO

Sign In for Pricing
View Details