Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acd Peptide - C-terminal region

Acd Peptide - C-terminal region

Product Specifications

UniProt

Q5EE38

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Acd Rabbit Polyclonal Antibody (orb576105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012656

Preservative

Lyophilized powder

AA Sequence

PRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GTP Cyclohydrolase 1 (GCH1) ELISA Kit
QY-E04899 96 Tests

Human GTP Cyclohydrolase 1 (GCH1) ELISA Kit

Sign In for Pricing
View Details
Magic™ Mouse Anti-Canine Rotavirus Monoclonal antibody, clone 118B
CABT-CS629 1mg

Magic™ Mouse Anti-Canine Rotavirus Monoclonal antibody, clone 118B

Sign In for Pricing
View Details
Zebrafish IDH3B Rabbit Polyclonal Antibody (HRP)
orb2804932 100 µg

Zebrafish IDH3B Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Rat Kif26a Pre-designed siRNA Set A
SI207238A 1 Each

Rat Kif26a Pre-designed siRNA Set A

Sign In for Pricing
View Details
PEX14 Peptide - middle region
orb1999784 100 µg

PEX14 Peptide - middle region

Sign In for Pricing
View Details
Calmodulin-3, N-terminal fragment (20 amino acids)
058-31 100 µg

Calmodulin-3, N-terminal fragment (20 amino acids)

Sign In for Pricing
View Details