ACER1 Peptide - C-terminal region
ACER1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ASAH3, MGC138327, MGC138329, ALKCDase1
UniProt
Q8TDN7
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACER1 Rabbit Polyclonal Antibody (orb584812) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_597999
Preservative
Lyophilized powder
AA Sequence
VNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ROBO1 Recombinant Mouse Monoclonal Antibody [10E2-R]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea81e83/imageurl/ha601056.webp)
HA601056 100 µL
ROBO1 Recombinant Mouse Monoclonal Antibody [10E2-R]
Sign In for Pricing
View Details 
BNC943526-100 1x 100 µL
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-AB-81539-01 50 µL
Recombinant cAMP Protein Kinase Catalytic Subunit Monoclonal Antibody
Sign In for Pricing
View Details E-AB-81539-02 100 µL
Recombinant cAMP Protein Kinase Catalytic Subunit Monoclonal Antibody
Sign In for Pricing
View Details 