Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACER1 Peptide - C-terminal region

ACER1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ASAH3, MGC138327, MGC138329, ALKCDase1

UniProt

Q8TDN7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACER1 Rabbit Polyclonal Antibody (orb584812) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_597999

Preservative

Lyophilized powder

AA Sequence

VNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serum Amyloid A (SAA/2868R), CF488A conjugate, 0.1mg/mL
BNC882868-100 1x 100 µL

Serum Amyloid A (SAA/2868R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMOC2 (NM_022138) Human Over-expression Lysate
LC402910 20 µg

SMOC2 (NM_022138) Human Over-expression Lysate

Sign In for Pricing
View Details
1,2,4-Triazole Sodium Salt
TRC-T767440-25G 25 g

1,2,4-Triazole Sodium Salt

Sign In for Pricing
View Details
HMGA1 (NM_145904) Human Recombinant Protein
TP317302 20 µg

HMGA1 (NM_145904) Human Recombinant Protein

Sign In for Pricing
View Details
CD74 (CLIP/1133), CF640R conjugate, 0.1mg/mL
BNC401133-100 1x 100 µL

CD74 (CLIP/1133), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acpp (Pain System Marker) Chicken Polyclonal Antibody
AP31817PU-N 200 µL

Acpp (Pain System Marker) Chicken Polyclonal Antibody

Sign In for Pricing
View Details