Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACER1 Peptide - C-terminal region

ACER1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ASAH3, MGC138327, MGC138329, ALKCDase1

UniProt

Q8TDN7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACER1 Rabbit Polyclonal Antibody (orb584813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_597999

Preservative

Lyophilized powder

AA Sequence

ITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC3A (NM_005752) Human Over-expression Lysate
E45H07860-2 20 µg

CLEC3A (NM_005752) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Acinus Antibody
24169 100 µL

Anti-Acinus Antibody

Sign In for Pricing
View Details
D030016E14Rik AAV siRNA Pooled Vector
17560164 1.0 µg

D030016E14Rik AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ZAK Antibody
MBS9430457-01 0.1 mL

ZAK Antibody

Sign In for Pricing
View Details
ZAK Antibody
MBS9430457-02 5x 0.1 mL

ZAK Antibody

Sign In for Pricing
View Details
Recombinant Streptococcus thermophilus MutS2 protein (mutS2), partial
MBS1282333 Inquire

Recombinant Streptococcus thermophilus MutS2 protein (mutS2), partial

Sign In for Pricing
View Details