Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACER1 Peptide - C-terminal region

ACER1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ASAH3, MGC138327, MGC138329, ALKCDase1

UniProt

Q8TDN7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACER1 Rabbit Polyclonal Antibody (orb584813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_597999

Preservative

Lyophilized powder

AA Sequence

ITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Standard rack (HxD) 5x5=25 boxes, 40mm, 214x683x139mm, B9
TE23036B 1 Piece

Standard rack (HxD) 5x5=25 boxes, 40mm, 214x683x139mm, B9

Sign In for Pricing
View Details
Porcine Na+/Ca2+Exchanger ELISA Kit
MBS029755-01 48 Well

Porcine Na+/Ca2+Exchanger ELISA Kit

Sign In for Pricing
View Details
Porcine Na+/Ca2+Exchanger ELISA Kit
MBS029755-02 96 Well

Porcine Na+/Ca2+Exchanger ELISA Kit

Sign In for Pricing
View Details
Porcine Na+/Ca2+Exchanger ELISA Kit
MBS029755-03 5x 96 Well

Porcine Na+/Ca2+Exchanger ELISA Kit

Sign In for Pricing
View Details
Porcine Na+/Ca2+Exchanger ELISA Kit
MBS029755-04 10x 96 Well

Porcine Na+/Ca2+Exchanger ELISA Kit

Sign In for Pricing
View Details
ARR3 Protein Vector (Mouse) (pPB-N-His)
PV156423 500 ng

ARR3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details