Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOT11 Peptide - middle region

ACOT11 Peptide - middle region

Product Specifications

Product Name Alternative

BFIT, BFIT1, BFIT2, KIAA0707, STARD14, THEA, THEM1

UniProt

D3DQ50

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACOT11 Rabbit Polyclonal Antibody (orb582693) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_671517

Preservative

Lyophilized powder

AA Sequence

AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD294 / PTGDR2 Monoclonal Antibody
ANT-11070-50ug 50 µg

CD294 / PTGDR2 Monoclonal Antibody

Sign In for Pricing
View Details
TG3, cleaved (APG3, APG3-LIKE, APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96, 2610016C12Rik, APG3 autophagy 3-like, autophagy Apg3p/Aut1p-like, autophagy-related protein 3, hApg3) (MaxLight 650)
MBS6355159-01 0.1 mL

TG3, cleaved (APG3, APG3-LIKE, APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96, 2610016C12Rik, APG3 autophagy 3-like, autophagy Apg3p/Aut1p-like, autophagy-related protein 3, hApg3) (MaxLight 650)

Sign In for Pricing
View Details
TG3, cleaved (APG3, APG3-LIKE, APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96, 2610016C12Rik, APG3 autophagy 3-like, autophagy Apg3p/Aut1p-like, autophagy-related protein 3, hApg3) (MaxLight 650)
MBS6355159-02 5x 0.1 mL

TG3, cleaved (APG3, APG3-LIKE, APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96, 2610016C12Rik, APG3 autophagy 3-like, autophagy Apg3p/Aut1p-like, autophagy-related protein 3, hApg3) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Human RAB2A Protein, N-His
HX083012-01 50 µg

Recombinant Human RAB2A Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RAB2A Protein, N-His
HX083012-02 100 µg

Recombinant Human RAB2A Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RAB2A Protein, N-His
HX083012-03 1 mg

Recombinant Human RAB2A Protein, N-His

Sign In for Pricing
View Details