Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOX3 Peptide - C-terminal region

ACOX3 Peptide - C-terminal region

Product Specifications

UniProt

O15254

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACOX3 Rabbit Polyclonal Antibody (orb584803) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003492

Preservative

Lyophilized powder

AA Sequence

SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (T-Cell Marker) (C3e/1931), CF488A conjugate, 0.1mg/mL
BNC881931-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/1931), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GBP5 Rabbit Polyclonal Antibody
TA364814 100 µL

GBP5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rnase10 Mouse Gene Knockout Kit (CRISPR)
KN514865 1 Kit

Rnase10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SLC26A6 activation kit by CRISPRa
GA112220 1 Kit

Human SLC26A6 activation kit by CRISPRa

Sign In for Pricing
View Details
Laminin (A5), CF543 conjugate, 0.1mg/mL
BNC430308-500 1x 500 µL

Laminin (A5), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMOC1 (NM_001034852) Human Recombinant Protein
TP304083 20 µg

SMOC1 (NM_001034852) Human Recombinant Protein

Sign In for Pricing
View Details