Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOX3 Peptide - C-terminal region

ACOX3 Peptide - C-terminal region

Product Specifications

UniProt

O15254

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACOX3 Rabbit Polyclonal Antibody (orb584803) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003492

Preservative

Lyophilized powder

AA Sequence

SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC39A3 Rabbit Polyclonal Antibody
AP31254PU-N 50 µg

SLC39A3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WNT8A Human Gene Knockout Kit (CRISPR)
KN424816 1 Kit

WNT8A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Milk Fat Globulin (EDM45), CF488A conjugate, 0.1mg/mL
BNC880942-100 1x 100 µL

Milk Fat Globulin (EDM45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF-A (VEGF/1063), CF740 conjugate, 0.1mg/mL
BNC741063-500 1x 500 µL

VEGF-A (VEGF/1063), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pyrrole-2,3,5-tricarboxylic Acid
TRC-P997885-5MG 5 mg

Pyrrole-2,3,5-tricarboxylic Acid

Sign In for Pricing
View Details
Recombinant Human CD96 Protein (His Tag)
PKSH033505-01 10 µg

Recombinant Human CD96 Protein (His Tag)

Sign In for Pricing
View Details