Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acp2 Peptide - middle region

Acp2 Peptide - middle region

Product Specifications

Product Name Alternative

LAP, Acp2

UniProt

Q642D2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Acp2 Rabbit Polyclonal Antibody (orb330401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058684

Preservative

Lyophilized powder

AA Sequence

GQALRQRYHGFLNASYHRQEVYVRSTDFDRTLMSAEANLAGLFPPTEVQH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GOLGA3 Antibody Picoband® (Dylight488 Conjugate)
A07522-2-Dylight488 100 µg

Anti-GOLGA3 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Rabbit Polyclonal TOP2B Antibody [Alexa Fluor 594]
NBP2-97789AF594 0.1 mL

Rabbit Polyclonal TOP2B Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
ILK Antibody - C-terminal region (ARP30445_P050)
ARP30445_P050 100 µL

ILK Antibody - C-terminal region (ARP30445_P050)

Sign In for Pricing
View Details
BRD3 Antibody
orb1557416-01 50 μL

BRD3 Antibody

Sign In for Pricing
View Details
BRD3 Antibody
orb1557416-02 100 µL

BRD3 Antibody

Sign In for Pricing
View Details
BRD3 Antibody
orb1557416-03 200 µL

BRD3 Antibody

Sign In for Pricing
View Details