Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acp2 Peptide - middle region

Acp2 Peptide - middle region

Product Specifications

Product Name Alternative

LAP, Acp2

UniProt

Q642D2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Acp2 Rabbit Polyclonal Antibody (orb330401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058684

Preservative

Lyophilized powder

AA Sequence

GQALRQRYHGFLNASYHRQEVYVRSTDFDRTLMSAEANLAGLFPPTEVQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM90A15P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV761109 1.0 µg DNA

FAM90A15P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Na-Methyl-L-lysine hydrochloride ≥95% (HPLC)
240684-01 100 mg

Na-Methyl-L-lysine hydrochloride ≥95% (HPLC)

Sign In for Pricing
View Details
Na-Methyl-L-lysine hydrochloride ≥95% (HPLC)
240684-02 250 mg

Na-Methyl-L-lysine hydrochloride ≥95% (HPLC)

Sign In for Pricing
View Details
Na-Methyl-L-lysine hydrochloride ≥95% (HPLC)
240684-03 1 g

Na-Methyl-L-lysine hydrochloride ≥95% (HPLC)

Sign In for Pricing
View Details
Na-Methyl-L-lysine hydrochloride ≥95% (HPLC)
240684-04 5 g

Na-Methyl-L-lysine hydrochloride ≥95% (HPLC)

Sign In for Pricing
View Details
Caveolin 3 Rabbit mAb
E2R380667 100 µL

Caveolin 3 Rabbit mAb

Sign In for Pricing
View Details