Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACP5 Peptide - N-terminal region

ACP5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC117378, TRAP, SPENCDI

UniProt

P13686

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACP5 Rabbit Polyclonal Antibody (orb578081) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001602

Preservative

Lyophilized powder

AA Sequence

DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC30 (NM_001105581) Human Over-expression Lysate
LS339291-20ug 20 µg

LRRC30 (NM_001105581) Human Over-expression Lysate

Sign In for Pricing
View Details
Kappa Light Chain (B-Cell Marker)
MBS4380041-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Kappa Light Chain (B-Cell Marker)

Sign In for Pricing
View Details
Kappa Light Chain (B-Cell Marker)
MBS4380041-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

Kappa Light Chain (B-Cell Marker)

Sign In for Pricing
View Details
Kappa Light Chain (B-Cell Marker)
MBS4380041-03 0.1 mg (Without BSA & Azide at 1mg/mL)

Kappa Light Chain (B-Cell Marker)

Sign In for Pricing
View Details
Kappa Light Chain (B-Cell Marker)
MBS4380041-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

Kappa Light Chain (B-Cell Marker)

Sign In for Pricing
View Details
Kappa Light Chain (B-Cell Marker)
MBS4380041-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)

Kappa Light Chain (B-Cell Marker)

Sign In for Pricing
View Details