Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSF2 Peptide - C-terminal region

ACSF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACSMW, AVYV493, FLJ20920

UniProt

Q8VCW8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACSF2 Rabbit Polyclonal Antibody (orb584804) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079425

Preservative

Lyophilized powder

AA Sequence

DLVVAYGTTENSPVTFAHFPEDTVEQKAESVGRIMPHTEARIMNMEAGTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetylthiocholine Iodide
TRC-A164610-25G 25 g

Acetylthiocholine Iodide

Sign In for Pricing
View Details
SGT1 (ECD) (NM_001135752) Human Over-expression Lysate
LY427697 100 µg

SGT1 (ECD) (NM_001135752) Human Over-expression Lysate

Sign In for Pricing
View Details
APC Anti-Mouse CD127/IL-7RA Antibody[A7R34]
E-AB-F1023UE-01 25 µg

APC Anti-Mouse CD127/IL-7RA Antibody[A7R34]

Sign In for Pricing
View Details
APC Anti-Mouse CD127/IL-7RA Antibody[A7R34]
E-AB-F1023UE-02 100 µg

APC Anti-Mouse CD127/IL-7RA Antibody[A7R34]

Sign In for Pricing
View Details
Mouse Oasl2 activation kit by CRISPRa
GA204836 1 Kit

Mouse Oasl2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human CCL17 Protein (His Tag)
PDEH101124-01 20 µg

Recombinant Human CCL17 Protein (His Tag)

Sign In for Pricing
View Details