Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSM3 Peptide - C-terminal region

ACSM3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SA, SAH

UniProt

Q53FZ2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACSM3 Rabbit Polyclonal Antibody (orb584805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005613

Preservative

Lyophilized powder

AA Sequence

DQEQLIKEIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABIN3 Antibody
5303-01 0.02 mg

ABIN3 Antibody

Sign In for Pricing
View Details
ABIN3 Antibody
5303-02 0.1 mg

ABIN3 Antibody

Sign In for Pricing
View Details
DNA Primase (PRIM2) (NM_001282488) Human Tagged ORF Clone
RG236156 10 µg

DNA Primase (PRIM2) (NM_001282488) Human Tagged ORF Clone

Sign In for Pricing
View Details
Uracil-DNA Glycosylase (UNG) Antibody (Biotin)
abx314382-01 20 µg

Uracil-DNA Glycosylase (UNG) Antibody (Biotin)

Sign In for Pricing
View Details
Uracil-DNA Glycosylase (UNG) Antibody (Biotin)
abx314382-02 50 µg

Uracil-DNA Glycosylase (UNG) Antibody (Biotin)

Sign In for Pricing
View Details
Uracil-DNA Glycosylase (UNG) Antibody (Biotin)
abx314382-03 100 µg

Uracil-DNA Glycosylase (UNG) Antibody (Biotin)

Sign In for Pricing
View Details