Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSM3 Peptide - C-terminal region

ACSM3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SA, SAH

UniProt

Q53FZ2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACSM3 Rabbit Polyclonal Antibody (orb584805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005613

Preservative

Lyophilized powder

AA Sequence

DQEQLIKEIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human IL15RA pAb
PA5237-01 50 μL

Rabbit Anti-Human IL15RA pAb

Sign In for Pricing
View Details
Rabbit Anti-Human IL15RA pAb
PA5237-02 100 μL

Rabbit Anti-Human IL15RA pAb

Sign In for Pricing
View Details
Olfr434 Lentiviral Activation Particles (m)
sc-434521-LAC 200 µL

Olfr434 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
FOS Rabbit pAb
E45R23659N-100 100 µL

FOS Rabbit pAb

Sign In for Pricing
View Details
FAS Antibody
E18-5342-1 50 µg - 50 µL

FAS Antibody

Sign In for Pricing
View Details
Geldanamycin 5mg
A11025-5 5 mg

Geldanamycin 5mg

Sign In for Pricing
View Details