Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSM3 Peptide - N-terminal region

ACSM3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SA, SAH

UniProt

Q53FZ2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACSM3 Rabbit Polyclonal Antibody (orb584806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005613

Preservative

Lyophilized powder

AA Sequence

SMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam50b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3205607 1.0 µg DNA

Fam50b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
P150 CAF1 Rabbit Monoclonal Antibody
E56G3482 100 µL

P150 CAF1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HOXA10 Antibody
GWB-CE0CD3 0.1 mg

HOXA10 Antibody

Sign In for Pricing
View Details
ZFP36L1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2536165 100 µL

ZFP36L1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Kcnab1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3657205 3x 1.0 µg

Kcnab1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
hsa-miR-6889-5p miRNA Antagomir
MNH03736 2x 5.0 nmol

hsa-miR-6889-5p miRNA Antagomir

Sign In for Pricing
View Details