Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSM3 Peptide - N-terminal region

ACSM3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SA, SAH

UniProt

Q53FZ2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACSM3 Rabbit Polyclonal Antibody (orb584806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005613

Preservative

Lyophilized powder

AA Sequence

SMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nrxn3 (BC060719) Mouse Tagged Lenti ORF Clone
MR212043L4 10 µg

Nrxn3 (BC060719) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
L-Alanyl-L-Glutamine Impurity 6
RM-A010748-01 10 mg

L-Alanyl-L-Glutamine Impurity 6

Sign In for Pricing
View Details
L-Alanyl-L-Glutamine Impurity 6
RM-A010748-02 25 mg

L-Alanyl-L-Glutamine Impurity 6

Sign In for Pricing
View Details
L-Alanyl-L-Glutamine Impurity 6
RM-A010748-03 50 mg

L-Alanyl-L-Glutamine Impurity 6

Sign In for Pricing
View Details
L-Alanyl-L-Glutamine Impurity 6
RM-A010748-04 100 mg

L-Alanyl-L-Glutamine Impurity 6

Sign In for Pricing
View Details
Anti-Human lgE Antibody (121), PE
MBS1585257-01 50 Tests

Anti-Human lgE Antibody (121), PE

Sign In for Pricing
View Details