Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSS2 Peptide - N-terminal region

ACSS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACAS2, ACECS, ACS, ACSA, DKFZp762G026, dJ1161H23.1

UniProt

Q4G0E8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACSS2 Rabbit Polyclonal Antibody (orb584906) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229322

Preservative

Lyophilized powder

AA Sequence

NICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NE Purified anti-mouse/rat CD126 (IL-6Rα chain)
E16FRY126-500U 500 µg

NE Purified anti-mouse/rat CD126 (IL-6Rα chain)

Sign In for Pricing
View Details
CHCHD2 Rabbit Polyclonal Antibody (AP)
orb952802 100 µL

CHCHD2 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
SARS-CoV-2 Surrogate Virus Neutralization Test Kit (B.1.1.7/N501Y)
KAV99905 96 Tests

SARS-CoV-2 Surrogate Virus Neutralization Test Kit (B.1.1.7/N501Y)

Sign In for Pricing
View Details
B33-75x25-7598-YL Pre-sized Tags for Printers
197561 500 Roll (500 Label x 1 Roll)

B33-75x25-7598-YL Pre-sized Tags for Printers

Sign In for Pricing
View Details
Zfp868 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4857406 1.0 µg DNA

Zfp868 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rabbit Anti-Human Cleaved-Plasminogen HC A short form (V98) Polyclonal Antibody
PA85193HU-01 50 µg

Rabbit Anti-Human Cleaved-Plasminogen HC A short form (V98) Polyclonal Antibody

Sign In for Pricing
View Details