Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSS2 Peptide - N-terminal region

ACSS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACAS2, ACECS, ACS, ACSA, DKFZp762G026, dJ1161H23.1

UniProt

Q4G0E8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACSS2 Rabbit Polyclonal Antibody (orb584906) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229322

Preservative

Lyophilized powder

AA Sequence

NICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC689322 3'UTR GFP Stable Cell Line
TU261883 1.0 mL

LOC689322 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TRAK1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-5536R-BF488 100 µL

TRAK1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
PSMB4 Antibody
MBS9608101-01 0.1 mL

PSMB4 Antibody

Sign In for Pricing
View Details
PSMB4 Antibody
MBS9608101-02 0.2 mL

PSMB4 Antibody

Sign In for Pricing
View Details
PSMB4 Antibody
MBS9608101-03 5x 0.2 mL

PSMB4 Antibody

Sign In for Pricing
View Details
Phospho-ADRB2 (Ser346) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-3002R-BF488 100 µL

Phospho-ADRB2 (Ser346) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details