Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR1B Peptide - middle region

ACTR1B Peptide - middle region

Product Specifications

Product Name Alternative

ARP1B, CTRN2, PC3

UniProt

P42025

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTR1B Rabbit Polyclonal Antibody (orb330661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005726

Preservative

Lyophilized powder

AA Sequence

VGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ADM (Adrenomedullin) CLIA Kit
E-CL-H0228-01 24 Tests

Human ADM (Adrenomedullin) CLIA Kit

Sign In for Pricing
View Details
Human ADM (Adrenomedullin) CLIA Kit
E-CL-H0228-02 48 Tests

Human ADM (Adrenomedullin) CLIA Kit

Sign In for Pricing
View Details
Human ADM (Adrenomedullin) CLIA Kit
E-CL-H0228-03 96 Tests

Human ADM (Adrenomedullin) CLIA Kit

Sign In for Pricing
View Details
CO2 Incubator Air Jacketed BCAJ-6802
BCAJ-6802 1 Unit

CO2 Incubator Air Jacketed BCAJ-6802

Sign In for Pricing
View Details
CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-500 1x 500 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse CD155/PVR Protein (aa 1-345, His Tag)
PKSM040773 100 µg

Recombinant Mouse CD155/PVR Protein (aa 1-345, His Tag)

Sign In for Pricing
View Details