Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR3 Peptide - N-terminal region

ACTR3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARP3

UniProt

P61158

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTR3 Rabbit Polyclonal Antibody (orb581567) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005712

Preservative

Lyophilized powder

AA Sequence

IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASL12 (NM_016563) Human Recombinant Protein
TP308117L 1 mg

RASL12 (NM_016563) Human Recombinant Protein

Sign In for Pricing
View Details
Human KIAA1430 (CFAP97) activation kit by CRISPRa
GA111613 1 Kit

Human KIAA1430 (CFAP97) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS502790 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2579), 0.2mg/mL
BNUB2579-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2579), 0.2mg/mL

Sign In for Pricing
View Details
CDKL5 (NM_001037343) Human Over-expression Lysate
LC421909 20 µg

CDKL5 (NM_001037343) Human Over-expression Lysate

Sign In for Pricing
View Details
Guanylin (GUCA2A) (NM_033553) Human Recombinant Protein
TP317195 20 µg

Guanylin (GUCA2A) (NM_033553) Human Recombinant Protein

Sign In for Pricing
View Details