Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR3 Peptide - N-terminal region

ACTR3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARP3

UniProt

P61158

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTR3 Rabbit Polyclonal Antibody (orb581567) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005712

Preservative

Lyophilized powder

AA Sequence

IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), Biotin conjugate, 0.1mg/mL
BNCB0305-100 1x 100 µL

CD95 (B-R18), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colq Mouse Gene Knockout Kit (CRISPR)
KN503661 1 Kit

Colq Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS802282 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2791), CF405S conjugate, 0.1mg/mL
BNC042791-500 1x 500 µL

Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2791), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RASGRP3 activation kit by CRISPRa
GA108532 1 Kit

Human RASGRP3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS801820 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details